Atpaf2 Peptide - middle region
Atpaf2 Peptide - middle region
Product Specifications
UniProt
D3ZTW7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Atpaf2 Rabbit Polyclonal Antibody (orb585242) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001100476
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TEWDSQQDTIKFYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTIC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
10115010-AAT 100 Tests
IFluor® 350 Anti-human CD11a Antibody *TS-1/22.1.1.13*
Sign In for Pricing
View Details 
![Mouse Monoclonal STING/TMEM173 Antibody (723505) [mFluor Violet 610 SE]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
FAB7169MFV610 0.1 mL
Mouse Monoclonal STING/TMEM173 Antibody (723505) [mFluor Violet 610 SE]
Sign In for Pricing
View Details RP11023W 24 Tests/Kit
Cowingene SARS-CoV-2 & Influenza A/B Detection Kit
Sign In for Pricing
View Details GTR15334612 1 Vial
Lentiviral human SSC4D shRNA (UAS) - Lentiviral human SSC4D shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details Al40-123A 1 mg
Goal anti-Raccoon IgG Heavy and Light Chain Antibody, Affinity Purified
Sign In for Pricing
View Details