Cuedc2 Peptide - middle region
Cuedc2 Peptide - middle region
Product Specifications
Product Name Alternative
3010002G01Rik
UniProt
Q9CXX9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Cuedc2 Rabbit Polyclonal Antibody (orb585382) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001157762
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IPRGIIGDMMQKLSVQLSDARNKENLHPQSSCVQGQVPIFPETPRQAEKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
YP-W37822-01 48 Tests
Rat Wingless Type MMTV Integration Site Family, Member 2 (WNT2) ELISA Kit
Sign In for Pricing
View Details YP-W37822-02 96 Tests
Rat Wingless Type MMTV Integration Site Family, Member 2 (WNT2) ELISA Kit
Sign In for Pricing
View Details bs-5239R-RBITC 100 µL
Phospho-CDKN1A/p21 (Ser146) Polyclonal Antibody, RBITC Conjugated
Sign In for Pricing
View Details K0646905 3x 1.0 µg
DYX3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details