Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cuedc2 Peptide - middle region

Cuedc2 Peptide - middle region

Product Specifications

Product Name Alternative

3010002G01Rik

UniProt

Q9CXX9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cuedc2 Rabbit Polyclonal Antibody (orb585382) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157762

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IPRGIIGDMMQKLSVQLSDARNKENLHPQSSCVQGQVPIFPETPRQAEKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC51B Antibody
OACA09915-100UG 100 µg

SLC51B Antibody

Sign In for Pricing
View Details
Myoz1 3'UTR Lenti-reporter-Luc Vector
31314084 1.0 µg

Myoz1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Celestine Blue B
C9620-01 1 g

Celestine Blue B

Sign In for Pricing
View Details
Celestine Blue B
C9620-02 5 g

Celestine Blue B

Sign In for Pricing
View Details
Bisubstrate Inhibitor 78 HCl
T36802L-01 1 mg

Bisubstrate Inhibitor 78 HCl

Sign In for Pricing
View Details
Bisubstrate Inhibitor 78 HCl
T36802L-02 5 mg

Bisubstrate Inhibitor 78 HCl

Sign In for Pricing
View Details