Ppp1ca Peptide - C-terminal region
Ppp1ca Peptide - C-terminal region
Product Specifications
Product Name Alternative
Ppp1c, dism2
UniProt
P62137
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ppp1ca Rabbit Polyclonal Antibody (orb331190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_114074
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![ITGB1BP3 (NMRK2) Mouse Monoclonal Antibody [Clone ID: OTI3H9]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908e8c/imageurl/cf813058.webp)
CF813058 100 µg
ITGB1BP3 (NMRK2) Mouse Monoclonal Antibody [Clone ID: OTI3H9]
Sign In for Pricing
View Details 
16050-AAT 1 mg
ROS Brite™ APF *Optimized for Detecting Reactive Oxygen Species (ROS) *
Sign In for Pricing
View Details ![GST-Tag Mouse Monoclonal Antibody [Clone ID: 12G8]](https://cdn.genprice.uk/products/937/68dd189c061270361e8fc871/imageurl/am20779pu-s.webp)
AM20779PU-S 50 µL
GST-Tag Mouse Monoclonal Antibody [Clone ID: 12G8]
Sign In for Pricing
View Details 
LC400260 20 µg
Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Over-expression Lysate
Sign In for Pricing
View Details 