Ppp1ca Peptide - C-terminal region
Ppp1ca Peptide - C-terminal region
Product Specifications
Product Name Alternative
Ppp1c, dism2
UniProt
P62137
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ppp1ca Rabbit Polyclonal Antibody (orb331190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_114074
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042554-100 1x 100 µL
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY426434 100 µg
EPLIN (LIMA1) (NM_001113546) Human Over-expression Lysate
Sign In for Pricing
View Details 
