Gckr Peptide - middle region
Gckr Peptide - middle region
Product Specifications
Product Name Alternative
GKRP
UniProt
Q91X44
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Gckr Rabbit Polyclonal Antibody (orb331241) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_659158
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FLPVLVGFNPVSMARNDPIEDWRSTFRQVAERMQKMQEKQEAFVLNPAIG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI7B10]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907d14/imageurl/cf805408.webp)
CF805408 100 µg
p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI7B10]
Sign In for Pricing
View Details 
![Antizyme inhibitor 1 (AZIN1) Mouse Monoclonal Antibody [Clone ID: OTI3C3]](https://cdn.genprice.uk/products/937/68dd18bb061270361e9089bb/imageurl/cf810907.webp)
CF810907 100 µg
Antizyme inhibitor 1 (AZIN1) Mouse Monoclonal Antibody [Clone ID: OTI3C3]
Sign In for Pricing
View Details 
ICH1064-50mg 50 mg
Anti-Mouse CD90 (T24/31) In Vivo Antibody - Low Endotoxin
Sign In for Pricing
View Details 
RDR-MIP4a-Hu-01 96 Tests
Human Macrophage Inflammatory Protein 4 Alpha (MIP4a) ELISA Kit
Sign In for Pricing
View Details