Gckr Peptide - middle region
Gckr Peptide - middle region
Product Specifications
Product Name Alternative
GKRP
UniProt
Q91X44
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Gckr Rabbit Polyclonal Antibody (orb331241) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_659158
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FLPVLVGFNPVSMARNDPIEDWRSTFRQVAERMQKMQEKQEAFVLNPAIG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUM1876-50 1x 50 µL
Cytokeratin, Multi (Epithelial Marker) (rKRT/457), 1mg/mL
Sign In for Pricing
View Details 
BNC940478-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (E29), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042988-100 1x 100 µL
BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Cr1l Mouse Monoclonal Antibody [Clone ID: 512]](https://cdn.genprice.uk/products/937/68dd189d061270361e8fd109/imageurl/am31835pu-n.webp)