Gstt2 Peptide - middle region
Gstt2 Peptide - middle region
Product Specifications
Product Name Alternative
AI266894, Yrs, mGSTT2
UniProt
Q61133
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Gstt2 Rabbit Polyclonal Antibody (orb585805) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_034491
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: WHADNIRGTFGVLLWTKVLGPLIGVQVPQEKVERNRDRMVLVLQQLEDKF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880799-500 1x 500 µL
Cytokeratin 19 (KRT19/799), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040795-500 1x 500 µL
CD56 / NCAM (NCAM1/795), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details