Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cabp4 Peptide - C-terminal region

Cabp4 Peptide - C-terminal region

Product Specifications

UniProt

D3ZY59

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cabp4 Rabbit Polyclonal Antibody (orb585806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102396

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLGVRELRIAFREFDKDRDGRITVAELRQAAPALLGEPLEGTELDEMLRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Affinity purified Rabbit polyclonal VIPR1 antibody
MBS5304708-01 0.1 mg

Affinity purified Rabbit polyclonal VIPR1 antibody

Sign In for Pricing
View Details
Affinity purified Rabbit polyclonal VIPR1 antibody
MBS5304708-02 5x 0.1 mg

Affinity purified Rabbit polyclonal VIPR1 antibody

Sign In for Pricing
View Details
Recombinant Mouse Kelch repeat and BTB domain-containing protein 5 (Kbtbd5)
MBS1302187-01 0.02 mg (E-Coli)

Recombinant Mouse Kelch repeat and BTB domain-containing protein 5 (Kbtbd5)

Sign In for Pricing
View Details
Recombinant Mouse Kelch repeat and BTB domain-containing protein 5 (Kbtbd5)
MBS1302187-02 0.02 mg (Yeast)

Recombinant Mouse Kelch repeat and BTB domain-containing protein 5 (Kbtbd5)

Sign In for Pricing
View Details
Recombinant Mouse Kelch repeat and BTB domain-containing protein 5 (Kbtbd5)
MBS1302187-03 0.1 mg (E-Coli)

Recombinant Mouse Kelch repeat and BTB domain-containing protein 5 (Kbtbd5)

Sign In for Pricing
View Details
Recombinant Mouse Kelch repeat and BTB domain-containing protein 5 (Kbtbd5)
MBS1302187-04 0.1 mg (Yeast)

Recombinant Mouse Kelch repeat and BTB domain-containing protein 5 (Kbtbd5)

Sign In for Pricing
View Details