Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cabp4 Peptide - C-terminal region

Cabp4 Peptide - C-terminal region

Product Specifications

UniProt

D3ZY59

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cabp4 Rabbit Polyclonal Antibody (orb585806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102396

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLGVRELRIAFREFDKDRDGRITVAELRQAAPALLGEPLEGTELDEMLRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC2L1 Rabbit Polyclonal Antibody (BF647)
orb2409048 100 µL

CDC2L1 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Rabbit Polyclonal SCAMP5 Antibody [DyLight 350]
NB120-3432UV 0.1 mL

Rabbit Polyclonal SCAMP5 Antibody [DyLight 350]

Sign In for Pricing
View Details
T-type Ca++ CP α1I CRISPR/Cas9 KO Plasmid (h)
sc-403786 20 µg

T-type Ca++ CP α1I CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Guinea Pig Soluble Guanylate Cyclase ELISA Kit
MBS7258154-01 48 Well

Guinea Pig Soluble Guanylate Cyclase ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Soluble Guanylate Cyclase ELISA Kit
MBS7258154-02 96 Well

Guinea Pig Soluble Guanylate Cyclase ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Soluble Guanylate Cyclase ELISA Kit
MBS7258154-03 5x 96 Well

Guinea Pig Soluble Guanylate Cyclase ELISA Kit

Sign In for Pricing
View Details