Mstn Peptide - C-terminal region
Mstn Peptide - C-terminal region
Product Specifications
Product Name Alternative
Cmpt, Gdf8
UniProt
O08689
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mstn Rabbit Polyclonal Antibody (orb331263) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_034964
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: APKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPIN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PTEN Mouse Monoclonal Antibody [Clone ID: 7H2-6G9-6H5]](https://cdn.genprice.uk/products/937/6868c2cf994c49e6dc3e78fb/imageurl/ta385075.webp)
TA385075 100 µL
PTEN Mouse Monoclonal Antibody [Clone ID: 7H2-6G9-6H5]
Sign In for Pricing
View Details 
![Elab Fluor® 700 Anti-Human CD4 Antibody[RPA-T4]](https://cdn.genprice.uk/products/763/68dd14ae061270361e7d3486/imageurl/e-ab-f1109m1.webp)
E-AB-F1109M1-01 20 Tests
Elab Fluor® 700 Anti-Human CD4 Antibody[RPA-T4]
Sign In for Pricing
View Details E-AB-F1109M1-02 100 Tests
Elab Fluor® 700 Anti-Human CD4 Antibody[RPA-T4]
Sign In for Pricing
View Details E-AB-F1109M1-03 2x 100 Tests
Elab Fluor® 700 Anti-Human CD4 Antibody[RPA-T4]
Sign In for Pricing
View Details