Mstn Peptide - C-terminal region
Mstn Peptide - C-terminal region
Product Specifications
Product Name Alternative
Cmpt, Gdf8
UniProt
O08689
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mstn Rabbit Polyclonal Antibody (orb331263) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_034964
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: APKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPIN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042697-500 1x 500 µL
PMEPA1 / TMEPAI (Tumor Suppressor Oncoprotein) (PMEPA1/2697), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSM040987-01 10 µg
Recombinant Mouse COL18A1/Endostatin Protein (His Tag)
Sign In for Pricing
View Details PKSM040987-02 50 µg
Recombinant Mouse COL18A1/Endostatin Protein (His Tag)
Sign In for Pricing
View Details 
AP14065PU-N 400 µL
Annexin A2 (ANXA2) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 