Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HGH1 Peptide - C-terminal region

HGH1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BRP16, BRP16L, FAM203A, FAM203B, C8orf30A, C8orf30B

UniProt

Q9BTY7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HGH1 Rabbit Polyclonal Antibody (orb587417) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057542

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADIRKMLVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC361914 sgRNA CRISPR Lentivector set (Rat)
K6652201 3x 1.0 µg

LOC361914 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
RSKB (MSK2) Antibody (C-term R321)
MBS9209293-01 0.08 mL

RSKB (MSK2) Antibody (C-term R321)

Sign In for Pricing
View Details
RSKB (MSK2) Antibody (C-term R321)
MBS9209293-02 0.4 mL

RSKB (MSK2) Antibody (C-term R321)

Sign In for Pricing
View Details
RSKB (MSK2) Antibody (C-term R321)
MBS9209293-03 5x 0.4 mL

RSKB (MSK2) Antibody (C-term R321)

Sign In for Pricing
View Details
Agrocybin
TN9115-01 10 mg

Agrocybin

Sign In for Pricing
View Details
Agrocybin
TN9115-02 50 mg

Agrocybin

Sign In for Pricing
View Details