HGH1 Peptide - C-terminal region
HGH1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
BRP16, BRP16L, FAM203A, FAM203B, C8orf30A, C8orf30B
UniProt
Q9BTY7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HGH1 Rabbit Polyclonal Antibody (orb587417) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057542
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ADIRKMLVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
DL-PIIINP-Hu-01 48 Tests
Human Procollagen III N-Terminal Propeptide (PIIINP) ELISA Kit
Sign In for Pricing
View Details DL-PIIINP-Hu-02 96 Tests
Human Procollagen III N-Terminal Propeptide (PIIINP) ELISA Kit
Sign In for Pricing
View Details 
21930064 1.0 µg DNA
Gm16501 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
K3653105 3x 1.0 µg
Tfb2m sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details