Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO46 Peptide - C-terminal region

FBXO46 Peptide - C-terminal region

Product Specifications

Product Name Alternative

20D7-FC4, FBXO34L, Fbx46

UniProt

Q6PJ61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXO46 Rabbit Polyclonal Antibody (orb587421) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073938

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDVVVTGVVDECIFFGKDGTKNVKEETVCLTVSPEEPPPPGQLFFLQNRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CRTC2 Pre-designed siRNA Set B
SI003647B 1 Each

Human CRTC2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Mouse IgG (H+L) Secondary Antibody [PE/Atto594]
NBP1-75154PEATT594 0.5 mL

Goat Polyclonal Goat anti-Mouse IgG (H+L) Secondary Antibody [PE/Atto594]

Sign In for Pricing
View Details
Polyclonal PTMA Antibody (C-Terminus)
APG01175G 0.05mg

Polyclonal PTMA Antibody (C-Terminus)

Sign In for Pricing
View Details
ID3 Mouse Monoclonal Antibody [Clone ID: OTI7B6]
TA500811 100 µL

ID3 Mouse Monoclonal Antibody [Clone ID: OTI7B6]

Sign In for Pricing
View Details
Rat Wdr46 Pre-designed siRNA Set B
SI215944B 1 Each

Rat Wdr46 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Candida glabrata Mitochondrial intermembrane space import and assembly protein 40 (MIA40), partial
MBS7090235 Inquire

Recombinant Candida glabrata Mitochondrial intermembrane space import and assembly protein 40 (MIA40), partial

Sign In for Pricing
View Details