Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO46 Peptide - C-terminal region

FBXO46 Peptide - C-terminal region

Product Specifications

Product Name Alternative

20D7-FC4, FBXO34L, Fbx46

UniProt

Q6PJ61

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXO46 Rabbit Polyclonal Antibody (orb587421) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073938

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDVVVTGVVDECIFFGKDGTKNVKEETVCLTVSPEEPPPPGQLFFLQNRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MAP2 Rabbit pAb
GB11128-2-50 50 μL

Anti-MAP2 Rabbit pAb

Sign In for Pricing
View Details
2,6-Pyridinedicarboxamide
sc-231219 10 g

2,6-Pyridinedicarboxamide

Sign In for Pricing
View Details
Commd6 ORF Vector (Mouse) (pORF)
16613015 1.0 µg DNA

Commd6 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
2-Chloro-6-fluoro-α- (4-methylphenyl) benzenemethanol
PC1009502-01 250 mg

2-Chloro-6-fluoro-α- (4-methylphenyl) benzenemethanol

Sign In for Pricing
View Details
2-Chloro-6-fluoro-α- (4-methylphenyl) benzenemethanol
PC1009502-02 1 g

2-Chloro-6-fluoro-α- (4-methylphenyl) benzenemethanol

Sign In for Pricing
View Details
2-Chloro-6-fluoro-α- (4-methylphenyl) benzenemethanol
PC1009502-03 5 g

2-Chloro-6-fluoro-α- (4-methylphenyl) benzenemethanol

Sign In for Pricing
View Details