FNDC7 Peptide - N-terminal region
FNDC7 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RP11-293A10.2
UniProt
Q5VTL7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FNDC7 Rabbit Polyclonal Antibody (orb587425) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001138409
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PGTVTGLKAATWYEITIRSISAAGRSQASPPKQAKTVLAAPILEVSSPSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470012-500 1x 500 µL
Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040630-500 1x 500 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB0026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), 0.2mg/mL
Sign In for Pricing
View Details 
BNC041388-100 1x 100 µL
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details