GAB4 Peptide - C-terminal region
GAB4 Peptide - C-terminal region
Product Specifications
UniProt
Q2WGN9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GAB4 Rabbit Polyclonal Antibody (orb587428) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001032903
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GTSSSAPPRSTGNIHYAALDFQPSKPSIGSVTSGKKVDYVQVDLEKTQAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882492-500 1x 500 µL
ATG5 (Autophagy Marker) (ATG5/2492), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GA117526 1 Kit
Human Leucine rich repeat containing protein 9 (LRRC9) activation kit by CRISPRa
Sign In for Pricing
View Details ![UPP2 Mouse Monoclonal Antibody [Clone ID: OTI10A3]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908d25/imageurl/cf812317.webp)
![Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: LAM03]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd539/imageurl/am33322pu-s.webp)
AM33322PU-S 100 µg
Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: LAM03]
Sign In for Pricing
View Details 
BNC941126-100 1x 100 µL
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details