Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAB4 Peptide - C-terminal region

GAB4 Peptide - C-terminal region

Product Specifications

UniProt

Q2WGN9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GAB4 Rabbit Polyclonal Antibody (orb587428) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032903

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTSSSAPPRSTGNIHYAALDFQPSKPSIGSVTSGKKVDYVQVDLEKTQAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKB epsilon (NFKBIE) Mouse Monoclonal Antibody [Clone ID: OTI6H8]
CF810713 100 µg

IKB epsilon (NFKBIE) Mouse Monoclonal Antibody [Clone ID: OTI6H8]

Sign In for Pricing
View Details
BAP1 (NM_004656) Human Over-expression Lysate
LY401476 100 µg

BAP1 (NM_004656) Human Over-expression Lysate

Sign In for Pricing
View Details
Casticin
TRC-C186000-5MG 5 mg

Casticin

Sign In for Pricing
View Details
FNDC5 Human Gene Knockout Kit (CRISPR)
KN212977LP 1 Kit

FNDC5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CF®568 Succinimidyl Ester
#92131 1x 1 µmol

CF®568 Succinimidyl Ester

Sign In for Pricing
View Details
Alx4 Mouse Gene Knockout Kit (CRISPR)
KN501175 1 Kit

Alx4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details