Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASTOR1 Peptide - C-terminal region

CASTOR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GATSL3

UniProt

Q8WTX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASTOR1 Rabbit Polyclonal Antibody (orb326997) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032755

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ICAM-1 (15.2) In Vivo Antibody - Low Endotoxin
ICH1027-50mg 50 mg

Anti-ICAM-1 (15.2) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS709806 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
4-Desacetamido-4-chloro Andarine
TRC-D289535-10MG 10 mg

4-Desacetamido-4-chloro Andarine

Sign In for Pricing
View Details
IL33 Antibody
KC-2336-01 50 μL

IL33 Antibody

Sign In for Pricing
View Details
IL33 Antibody
KC-2336-02 100 µL

IL33 Antibody

Sign In for Pricing
View Details
IL33 Antibody
KC-2336-03 1 mL

IL33 Antibody

Sign In for Pricing
View Details