Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASTOR1 Peptide - C-terminal region

CASTOR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GATSL3

UniProt

Q8WTX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASTOR1 Rabbit Polyclonal Antibody (orb326997) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032755

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPSSITFFAFSLIEGYISIVMDAETQKKFPSDLLLTSSSGELWRMVRIGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ly6g Polyclonal Antibody
E-AB-70094-01 60 µL

Ly6g Polyclonal Antibody

Sign In for Pricing
View Details
Ly6g Polyclonal Antibody
E-AB-70094-02 120 µL

Ly6g Polyclonal Antibody

Sign In for Pricing
View Details
Ly6g Polyclonal Antibody
E-AB-70094-03 200 µL

Ly6g Polyclonal Antibody

Sign In for Pricing
View Details
EBAG9 Human Gene Knockout Kit (CRISPR)
KN205364BN 1 Kit

EBAG9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Spiramycin
TRC-S682373-1G 1 g

Spiramycin

Sign In for Pricing
View Details
Primer Panel
HPP6008D 200x 96 reactions in matrix tubes

Primer Panel

Sign In for Pricing
View Details