RBM6 Peptide - C-terminal region
RBM6 Peptide - C-terminal region
Product Specifications
UniProt
B4E0G6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RBM6 Rabbit Polyclonal Antibody (orb574331) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YGQSKSFPEGKTARDAQRDLQDQDYRTGPSEEKPSRLIRLSGVPEDATKE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC402450 20 µg
Dynamin 3 (DNM3) (NM_015569) Human Over-expression Lysate
Sign In for Pricing
View Details 
