Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC39A10 Peptide - N-terminal region

SLC39A10 Peptide - N-terminal region

Product Specifications

UniProt

B4DGU0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC39A10 Rabbit Polyclonal Antibody (orb574447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EHCIRMFKHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP1/4 Antibody
MBS9430862-01 0.1 mL

DUSP1/4 Antibody

Sign In for Pricing
View Details
DUSP1/4 Antibody
MBS9430862-02 5x 0.1 mL

DUSP1/4 Antibody

Sign In for Pricing
View Details
Sialyltransferase 7B shRNA Plasmid (m)
sc-63017-SH 20 µg

Sialyltransferase 7B shRNA Plasmid (m)

Sign In for Pricing
View Details
DUXAP8 ORF Vector (Human) (pORF)
18739011 1.0 µg DNA

DUXAP8 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TFIIF RAP 30 CRISPR/Cas9 KO Plasmid (h)
sc-416804 20 µg

TFIIF RAP 30 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Cyp2a3 ORF Vector (Rat) (pORF)
ORF065693 1.0 µg DNA

Cyp2a3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details