SLC39A10 Peptide - N-terminal region
SLC39A10 Peptide - N-terminal region
Product Specifications
UniProt
B4DGU0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLC39A10 Rabbit Polyclonal Antibody (orb574447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EHCIRMFKHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB1409-500 1x 500 µL
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1409R), 0.2mg/mL
Sign In for Pricing
View Details 
abx505363 96 Tests
Human Coiled-coil domain-containing protein 34 (CCDC34) ELISA Kit
Sign In for Pricing
View Details 
bs-12406R-PE-Cy5 100 µL
SNX4 Polyclonal Antibody, PE-Cy5 Conjugated
Sign In for Pricing
View Details MBS1304020-01 0.02 mg (E-Coli)
Recombinant Dechloromonas aromatica Cell division topological specificity factor (minE)
Sign In for Pricing
View Details MBS1304020-02 0.1 mg (E-Coli)
Recombinant Dechloromonas aromatica Cell division topological specificity factor (minE)
Sign In for Pricing
View Details MBS1304020-03 0.02 mg (Yeast)
Recombinant Dechloromonas aromatica Cell division topological specificity factor (minE)
Sign In for Pricing
View Details