Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POGK Peptide - C-terminal region

POGK Peptide - C-terminal region

Product Specifications

UniProt

G3V1P0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POGK Rabbit Polyclonal Antibody (orb574457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKPVLVKTPGREKLKITAMLGVLADGRKLPPYIILRGTYIPPGKFPSGME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR83 Mouse Monoclonal Antibody [Clone 3E8]
E45M20486V-2 50 µL

GPR83 Mouse Monoclonal Antibody [Clone 3E8]

Sign In for Pricing
View Details
MTA1 (A-11) : m-IgGκ BP-HRP Bundle
sc-520647 1 Kit

MTA1 (A-11) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Human SP3 Pre-designed siRNA Set A
SI015537A 1 Each

Human SP3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Defa29 activation kit by CRISPRa
GA201053 1 Kit

Mouse Defa29 activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) SERA Polyclonal Antibody
MBS7141155 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) SERA Polyclonal Antibody

Sign In for Pricing
View Details
prefoldin 5 Double Nickase Plasmid (h)
sc-405510-NIC 20 µg

prefoldin 5 Double Nickase Plasmid (h)

Sign In for Pricing
View Details