Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POGK Peptide - C-terminal region

POGK Peptide - C-terminal region

Product Specifications

UniProt

G3V1P0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POGK Rabbit Polyclonal Antibody (orb574457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKPVLVKTPGREKLKITAMLGVLADGRKLPPYIILRGTYIPPGKFPSGME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Catenin-alpha E/N Polyclonal Antibody
MBS9414338-01 0.05 mL

Catenin-alpha E/N Polyclonal Antibody

Sign In for Pricing
View Details
Catenin-alpha E/N Polyclonal Antibody
MBS9414338-02 0.1 mL

Catenin-alpha E/N Polyclonal Antibody

Sign In for Pricing
View Details
Catenin-alpha E/N Polyclonal Antibody
MBS9414338-03 5x 0.1 mL

Catenin-alpha E/N Polyclonal Antibody

Sign In for Pricing
View Details
THRB Antibody [K5L2]
F3941-100uL*2 2x 100 μL

THRB Antibody [K5L2]

Sign In for Pricing
View Details
ZNF785 Polyclonal Antibody
orb1411765 100 µL

ZNF785 Polyclonal Antibody

Sign In for Pricing
View Details
NMDAε4 CRISPR Activation Plasmid (m2)
sc-420692-ACT-2 20 µg

NMDAε4 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details