Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP4K5 Peptide - C-terminal region

MAP4K5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GCKR, KHS, KHS1, MAPKKKK5

UniProt

Q9Y4K4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAP4K5 Rabbit Polyclonal Antibody (orb574511) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_942089

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILAGHENS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pepinemab Biosimilar - Anti-SEMA4D mAb - Research Grade
PX-TA1382-1000UG 1 mg

Pepinemab Biosimilar - Anti-SEMA4D mAb - Research Grade

Sign In for Pricing
View Details
AKT3 (v-akt murine Thymoma Viral Oncogene Homolog 3 (Protein Kinase B, gamma), DKFZp434N0250, PKB-GAMMA, PKBG, PRKBG, RAC-PK-gamma, RAC-gamma, STK-2) (MaxLight 405) discontinued
243232-ML405 100 µL

AKT3 (v-akt murine Thymoma Viral Oncogene Homolog 3 (Protein Kinase B, gamma), DKFZp434N0250, PKB-GAMMA, PKBG, PRKBG, RAC-PK-gamma, RAC-gamma, STK-2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Trpc6 shRNA (UAS) - Lentiviral mouse Trpc6 shRNA (UAS) (25)
GTR15223193 1 Vial

Lentiviral mouse Trpc6 shRNA (UAS) - Lentiviral mouse Trpc6 shRNA (UAS) (25)

Sign In for Pricing
View Details
Recombinant Hepatitis B Virus Core (1-183)
MBS142513-01 0.1 mg

Recombinant Hepatitis B Virus Core (1-183)

Sign In for Pricing
View Details
Recombinant Hepatitis B Virus Core (1-183)
MBS142513-02 0.5 mg

Recombinant Hepatitis B Virus Core (1-183)

Sign In for Pricing
View Details
Recombinant Hepatitis B Virus Core (1-183)
MBS142513-03 1 mg

Recombinant Hepatitis B Virus Core (1-183)

Sign In for Pricing
View Details