Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP4K5 Peptide - C-terminal region

MAP4K5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GCKR, KHS, KHS1, MAPKKKK5

UniProt

Q9Y4K4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAP4K5 Rabbit Polyclonal Antibody (orb574511) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_942089

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILAGHENS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JMJD8 (JmjC Domain-containing Protein 8, Jumonji Domain-containing Protein 8, C16orf20, PP14397) (MaxLight 490)
MBS6269721-01 0.1 mL

JMJD8 (JmjC Domain-containing Protein 8, Jumonji Domain-containing Protein 8, C16orf20, PP14397) (MaxLight 490)

Sign In for Pricing
View Details
JMJD8 (JmjC Domain-containing Protein 8, Jumonji Domain-containing Protein 8, C16orf20, PP14397) (MaxLight 490)
MBS6269721-02 5x 0.1 mL

JMJD8 (JmjC Domain-containing Protein 8, Jumonji Domain-containing Protein 8, C16orf20, PP14397) (MaxLight 490)

Sign In for Pricing
View Details
Prostaglandin A1
BML-PG001-0010 10 mg

Prostaglandin A1

Sign In for Pricing
View Details
STARD5 Rabbit Polyclonal Antibody (HRP)
orb469067 100 µL

STARD5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Zfp738 Protein Vector (Mouse) (pPM-C-HA)
PV250144 500 ng

Zfp738 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PCDHGB2, NT (PCDHGB2, Protocadherin gamma-B2) (MaxLight 490) discontinued
039757-ML490 100 µL

PCDHGB2, NT (PCDHGB2, Protocadherin gamma-B2) (MaxLight 490) discontinued

Sign In for Pricing
View Details