Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLDN4 Peptide - C-terminal region

CLDN4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CPE-R, CPER, CPETR, CPETR1, WBSCR8, hCPE-R

UniProt

O14493

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLDN4 Rabbit Polyclonal Antibody (orb574762) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001296

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSL5 Recombinant Mouse monoclonal Antibody
HA610053 100 µg

ACSL5 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Nucleocapsid Protein, Biotinylated (His Tag)
PKSR030512 20 µg

Recombinant SARS-CoV-2 Nucleocapsid Protein, Biotinylated (His Tag)

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-9E3), CF405S conjugate, 0.1mg/mL
BNC040010-100 1x 100 µL

MART-1 / Melan-A (M2-9E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ralgapa1 Mouse Gene Knockout Kit (CRISPR)
KN514442 1 Kit

Ralgapa1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Fmo1 activation kit by CRISPRa
GA201451 1 Kit

Mouse Fmo1 activation kit by CRISPRa

Sign In for Pricing
View Details
Ɑ-Butyric Acid NHS Ester-ω-Maleimidohexanamido PEG
1310000-65-35.1G 1 g

Ɑ-Butyric Acid NHS Ester-ω-Maleimidohexanamido PEG

Sign In for Pricing
View Details