Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dpysl5 Peptide - C-terminal region

Dpysl5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CRAM, CRMP-5, Crmp5

UniProt

Q9EQF6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dpysl5 Rabbit Polyclonal Antibody (orb585919) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075534

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aurkb Mouse siRNA Oligo Duplex (Locus ID 20877)
SR411647 1 Kit

Aurkb Mouse siRNA Oligo Duplex (Locus ID 20877)

Sign In for Pricing
View Details
Human RNF5 siRNA
abx904622-01 15 nmol

Human RNF5 siRNA

Sign In for Pricing
View Details
Human RNF5 siRNA
abx904622-02 30 nmol

Human RNF5 siRNA

Sign In for Pricing
View Details
Human asialoglyco protein receptor,ASGPR ELISA KIT
JOT-EK0278Hu-01 96 Well

Human asialoglyco protein receptor,ASGPR ELISA KIT

Sign In for Pricing
View Details
Human asialoglyco protein receptor,ASGPR ELISA KIT
JOT-EK0278Hu-02 48 Well

Human asialoglyco protein receptor,ASGPR ELISA KIT

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
BNC740177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details