Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dpysl5 Peptide - C-terminal region

Dpysl5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CRAM, CRMP-5, Crmp5

UniProt

Q9EQF6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dpysl5 Rabbit Polyclonal Antibody (orb585919) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075534

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR3K Antibody, Biotin conjugated
A31637-50UG 50 µg

POLR3K Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse Endostatin (ES) ELISA Kit-Sandwich
EK5F482-01 48 Test

Mouse Endostatin (ES) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Endostatin (ES) ELISA Kit-Sandwich
EK5F482-02 96 Tests

Mouse Endostatin (ES) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Caspase 3 p17 Blocking Peptide
abx062336-01 1 mg

Caspase 3 p17 Blocking Peptide

Sign In for Pricing
View Details
Caspase 3 p17 Blocking Peptide
abx062336-02 5 mg

Caspase 3 p17 Blocking Peptide

Sign In for Pricing
View Details
Rabbit Anti-Phospho-TAK1 (Thr187) antibody
SL3438R-01 50 µL

Rabbit Anti-Phospho-TAK1 (Thr187) antibody

Sign In for Pricing
View Details