Dpysl5 Peptide - C-terminal region
Dpysl5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CRAM, CRMP-5, Crmp5
UniProt
Q9EQF6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Dpysl5 Rabbit Polyclonal Antibody (orb585919) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_075534
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
334503-01 50 µL
SLC22A3 (Solute Carrier Family 22 Member 3, Extraneuronal monoamine Transporter, EMT, Organic cation Transporter 3, SLC22A3, EMTH, OCT3)
Sign In for Pricing
View Details 334503-02 100 µL
SLC22A3 (Solute Carrier Family 22 Member 3, Extraneuronal monoamine Transporter, EMT, Organic cation Transporter 3, SLC22A3, EMTH, OCT3)
Sign In for Pricing
View Details GTR15174442 1 Vial
Lentiviral mouse Csf2rb2 shRNA (UAS) - Lentiviral mouse Csf2rb2 shRNA (UAS, GFP) plasmid
Sign In for Pricing
View Details 172111-AF-APC 100 µL
IgG (G1m Marker, G2m Marker, G3m Marker, G4m Marker, HDC, Heavy Chain Disease Protein, Human Immunglobulin G, Ig gamma1/2/3/4 Chain C Region, IGHG1, IGHG2, IGHG3, IGHG4, Immunoglobulin Heavy Constant, Immunoglobulin Gamma Heavy Chain) (APC)
Sign In for Pricing
View Details 