Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dpysl5 Peptide - C-terminal region

Dpysl5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CRAM, CRMP-5, Crmp5

UniProt

Q9EQF6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dpysl5 Rabbit Polyclonal Antibody (orb585919) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075534

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant e.coli idnk protein
ATGP3239-004 4 µg

Recombinant e.coli idnk protein

Sign In for Pricing
View Details
Human Beta-defensin 125, DEFB125 ELISA Kit
MBS9327289-01 48 Well

Human Beta-defensin 125, DEFB125 ELISA Kit

Sign In for Pricing
View Details
Human Beta-defensin 125, DEFB125 ELISA Kit
MBS9327289-02 96 Well

Human Beta-defensin 125, DEFB125 ELISA Kit

Sign In for Pricing
View Details
Human Beta-defensin 125, DEFB125 ELISA Kit
MBS9327289-03 5x 96 Well

Human Beta-defensin 125, DEFB125 ELISA Kit

Sign In for Pricing
View Details
Human Beta-defensin 125, DEFB125 ELISA Kit
MBS9327289-04 10x 96 Well

Human Beta-defensin 125, DEFB125 ELISA Kit

Sign In for Pricing
View Details
Rad54B CRISPR Activation Plasmid (h)
sc-403794-ACT 20 µg

Rad54B CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details