Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccni Peptide - N-terminal region

Ccni Peptide - N-terminal region

Product Specifications

UniProt

D4A5E4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccni Rabbit Polyclonal Antibody (orb585955) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099468

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MKFPGPLENQRLSSLLERAISREAQMWKVNVPKIPTNQNVSPSQRDEVIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-mouse E3 ubiquitin-protein ligase TRIM21 polyclonal Antibody(Trim21), FITC
MBS1498512-01 0.05 mg

Rabbit anti-mouse E3 ubiquitin-protein ligase TRIM21 polyclonal Antibody(Trim21), FITC

Sign In for Pricing
View Details
Rabbit anti-mouse E3 ubiquitin-protein ligase TRIM21 polyclonal Antibody(Trim21), FITC
MBS1498512-02 0.1 mg

Rabbit anti-mouse E3 ubiquitin-protein ligase TRIM21 polyclonal Antibody(Trim21), FITC

Sign In for Pricing
View Details
Rabbit anti-mouse E3 ubiquitin-protein ligase TRIM21 polyclonal Antibody(Trim21), FITC
MBS1498512-03 5x 0.1 mg

Rabbit anti-mouse E3 ubiquitin-protein ligase TRIM21 polyclonal Antibody(Trim21), FITC

Sign In for Pricing
View Details
Rabbit Monoclonal Fascin Antibody (SAIC-32C-205) - Azide and BSA Free
NBP3-20100-0.2mg 0.2 mg

Rabbit Monoclonal Fascin Antibody (SAIC-32C-205) - Azide and BSA Free

Sign In for Pricing
View Details
N-Benzyl-4-chloro-5-sulfamoylanthranilic acid
sc-228666 1 g

N-Benzyl-4-chloro-5-sulfamoylanthranilic acid

Sign In for Pricing
View Details
Human SOST (Sclerostin) QuickTest ELISA Kit
QT-EH0599 96 Tests

Human SOST (Sclerostin) QuickTest ELISA Kit

Sign In for Pricing
View Details