Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccni Peptide - N-terminal region

Ccni Peptide - N-terminal region

Product Specifications

UniProt

D4A5E4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccni Rabbit Polyclonal Antibody (orb585955) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099468

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MKFPGPLENQRLSSLLERAISREAQMWKVNVPKIPTNQNVSPSQRDEVIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR10Q1 knockout cell line
ABC-KH10586 1 Vial

Human OR10Q1 knockout cell line

Sign In for Pricing
View Details
CD2 (MT910) Alexa Fluor® 647
sc-19638 AF647 200 µg/mL

CD2 (MT910) Alexa Fluor® 647

Sign In for Pricing
View Details
ASB3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
12513124 3x 1.0µg DNA

ASB3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
FGF1 Human qPCR Primer Pair (NM_000800)
HP200741 200 Reactions

FGF1 Human qPCR Primer Pair (NM_000800)

Sign In for Pricing
View Details
Rabbit Polyclonal GPR6 Antibody
NBP1-60013 100 µL

Rabbit Polyclonal GPR6 Antibody

Sign In for Pricing
View Details
ZFAND2A shRNA (h) Lentiviral Particles
sc-89827-V 200 µL

ZFAND2A shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details