Oprm1 Peptide - middle region
Oprm1 Peptide - middle region
Product Specifications
Product Name Alternative
M-OR-1, MOP-R, MOR-1, MOR-1O, Oprm, mor, muOR
UniProt
P42866
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Oprm1 Rabbit Polyclonal Antibody (orb585968) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001034741
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP21504PU-N 100 µg
OB Cadherin (CDH11) (497-509) Goat Polyclonal Antibody
Sign In for Pricing
View Details 
BNC941705-100 1x 100 µL
TCF4 (Transcription Factor 4) (TCF4/1705), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 