Oprm1 Peptide - middle region
Oprm1 Peptide - middle region
Product Specifications
Product Name Alternative
M-OR-1, MOP-R, MOR-1, MOR-1O, Oprm, mor, muOR
UniProt
P42866
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Oprm1 Rabbit Polyclonal Antibody (orb585968) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001034741
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CEACAM1 Mouse Monoclonal Antibody [Clone ID: B-D60]](https://cdn.genprice.uk/products/937/68dd189d061270361e8fcf98/imageurl/am31274fc-n.webp)
AM31274FC-N 1 mL (100 Tests)
CEACAM1 Mouse Monoclonal Antibody [Clone ID: B-D60]
Sign In for Pricing
View Details 
TRC-H948515-250MG 250 mg
(R)-3-Hydroxy Myristic Acid Dicyclohexylammonium Salt
Sign In for Pricing
View Details