Dmgdh Peptide - middle region
Dmgdh Peptide - middle region
Product Specifications
UniProt
Q5EBH4
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DMGDH Rabbit Polyclonal Antibody (orb586013) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SELHDLRWIEEAAFRGGYDVEIQNITDEFGVLGVAGPYARRVLQKLTSE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP47510_P050 100 µL
ARGFX antibody - N-terminal region (ARP47510_P050)
Sign In for Pricing
View Details 
217241-PE 100 µL
Calmodulin Binding Protein Epitope Tag (CBP-Tag) (PE) discontinued
Sign In for Pricing
View Details AZA0A0R4IMY7-FITC 100 µg/Vial
Anti-Zebrafish TRPM2 Antibody FITC Conjugated
Sign In for Pricing
View Details