Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gps2 Peptide - N-terminal region

Gps2 Peptide - N-terminal region

Product Specifications

UniProt

Q9WV81

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPS2 Rabbit Polyclonal Antibody (orb586016) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLNMQGSPGGHN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Avium rplD Protein(aa 1-217)
VAng-Yyj1418-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Avium rplD Protein(aa 1-217)

Sign In for Pricing
View Details
Guinea pig Melatonin ELISA Kit
MBS727976-01 48 Well

Guinea pig Melatonin ELISA Kit

Sign In for Pricing
View Details
Guinea pig Melatonin ELISA Kit
MBS727976-02 96 Well

Guinea pig Melatonin ELISA Kit

Sign In for Pricing
View Details
Guinea pig Melatonin ELISA Kit
MBS727976-03 5x 96 Well

Guinea pig Melatonin ELISA Kit

Sign In for Pricing
View Details
Guinea pig Melatonin ELISA Kit
MBS727976-04 10x 96 Well

Guinea pig Melatonin ELISA Kit

Sign In for Pricing
View Details
Camel Transcription Factor AP-2 Gamma (TFAP2C) ELISA Kit
MBS9930516 Inquire

Camel Transcription Factor AP-2 Gamma (TFAP2C) ELISA Kit

Sign In for Pricing
View Details