Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cog1 Peptide - C-terminal region

Cog1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

6030445I15, Ldlb, mKIAA1381

UniProt

Q9Z160

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cog1 Rabbit Polyclonal Antibody (orb331294) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038609

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENQIKKEGAFPMTQNRALQLLYDLRYLTMVLSSKGEEVKSGRSKADSRME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endothelial lipase
E8ER1908-11 100 µL

Endothelial lipase

Sign In for Pricing
View Details
Sodium Iodide Symporter (SLC5A5) (NM_000453) Human Over-expression Lysate
LC400159 20 µg

Sodium Iodide Symporter (SLC5A5) (NM_000453) Human Over-expression Lysate

Sign In for Pricing
View Details
Prostaglandin D Synthase, Hematopoietic form (PGD Synthase) (Not for Export EU)
P9053-25K 200 µL

Prostaglandin D Synthase, Hematopoietic form (PGD Synthase) (Not for Export EU)

Sign In for Pricing
View Details
Recombinant Human Lysozyme G-Like 2
32-4141-10 10 µg

Recombinant Human Lysozyme G-Like 2

Sign In for Pricing
View Details
2-Methyl-5- (pyridin-2-yl) aniline
OR1035705-01 50 mg

2-Methyl-5- (pyridin-2-yl) aniline

Sign In for Pricing
View Details
2-Methyl-5- (pyridin-2-yl) aniline
OR1035705-02 100 mg

2-Methyl-5- (pyridin-2-yl) aniline

Sign In for Pricing
View Details