Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cog1 Peptide - C-terminal region

Cog1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

6030445I15, Ldlb, mKIAA1381

UniProt

Q9Z160

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cog1 Rabbit Polyclonal Antibody (orb331294) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038609

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENQIKKEGAFPMTQNRALQLLYDLRYLTMVLSSKGEEVKSGRSKADSRME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trim9 (NM_001110203) Mouse Tagged Lenti ORF Clone
MR225800L4 10 µg

Trim9 (NM_001110203) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MRPS26 Protein Vector (Rat) (pPB-N-His)
PV283275 500 ng

MRPS26 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Nor Reticuline discontinued
285337 25 mg

Nor Reticuline discontinued

Sign In for Pricing
View Details
Mouse Monoclonal ALDH2 Antibody (7-D8-R)
NBP3-32022 100 µL

Mouse Monoclonal ALDH2 Antibody (7-D8-R)

Sign In for Pricing
View Details
Anti-Monkeypox Virus & incl Ectromelia Monoclonal Antibody (VACV-5B1), Human IgG1, Rabbit IgG, Kappa, Allophycocyanin (APC) conjugation
VACY-0922-CY277 Each

Anti-Monkeypox Virus & incl Ectromelia Monoclonal Antibody (VACV-5B1), Human IgG1, Rabbit IgG, Kappa, Allophycocyanin (APC) conjugation

Sign In for Pricing
View Details
Mouse CD248 siRNA
abx910974-01 15 nmol

Mouse CD248 siRNA

Sign In for Pricing
View Details