Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prepl Peptide - C-terminal region

Prepl Peptide - C-terminal region

Product Specifications

Product Name Alternative

2810457N15Rik, 9530014L06Rik, D030028O16Rik, mKIAA0436

UniProt

Q8C167

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prepl Rabbit Polyclonal Antibody (orb586048) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_666096

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRAVTLEAPFLDVLNTMLDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPGRIP1L Peptide - middle region
orb1999238 100 µg

RPGRIP1L Peptide - middle region

Sign In for Pricing
View Details
Mmu-miR-6960-5p miRNA Antagomir
orb1912336-01 10 nmol

Mmu-miR-6960-5p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-6960-5p miRNA Antagomir
orb1912336-02 20 nmol

Mmu-miR-6960-5p miRNA Antagomir

Sign In for Pricing
View Details
Recombinant Bovine Alpha s1 Casein, N-His Tag
bs-42025P-01 20 µg

Recombinant Bovine Alpha s1 Casein, N-His Tag

Sign In for Pricing
View Details
Recombinant Bovine Alpha s1 Casein, N-His Tag
bs-42025P-02 100 µg

Recombinant Bovine Alpha s1 Casein, N-His Tag

Sign In for Pricing
View Details
Recombinant Bovine Alpha s1 Casein, N-His Tag
bs-42025P-03 500 µg

Recombinant Bovine Alpha s1 Casein, N-His Tag

Sign In for Pricing
View Details