Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prepl Peptide - C-terminal region

Prepl Peptide - C-terminal region

Product Specifications

Product Name Alternative

2810457N15Rik, 9530014L06Rik, D030028O16Rik, mKIAA0436

UniProt

Q8C167

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prepl Rabbit Polyclonal Antibody (orb586048) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_666096

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRAVTLEAPFLDVLNTMLDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fra-1 (C-12) Alexa Fluor® 647
sc-28310 AF647 200 µg/mL

Fra-1 (C-12) Alexa Fluor® 647

Sign In for Pricing
View Details
LIAS Antibody
A27490-100UL 100 µL

LIAS Antibody

Sign In for Pricing
View Details
Pigeon Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5) ELISA Kit
MBS9931435 Inquire

Pigeon Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5) ELISA Kit

Sign In for Pricing
View Details
Anti-FOLH1/PSMA (MLN2704) Biosimilar (Monoclonal, IgG)
A136623 100 µL

Anti-FOLH1/PSMA (MLN2704) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details
Goat Polyclonal SOD2/Mn-SOD Antibody [DyLight 405]
NB200-165V 0.1 mL

Goat Polyclonal SOD2/Mn-SOD Antibody [DyLight 405]

Sign In for Pricing
View Details
CDC123 Human
OM303924-01 5 µg

CDC123 Human

Sign In for Pricing
View Details