Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Daam2 Peptide - N-terminal region

Daam2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310016D11Rik, AI843643, AW557870

UniProt

Q80U19

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Daam2 Rabbit Polyclonal Antibody (orb586163) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008232

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFAELVDELD LTDKNREAVFALPPEKKWQIYCSKRKEQEDPNKLATSWP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP2 Human Gene Knockout Kit (CRISPR)
KN402878 1 Kit

DUSP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Meninges
CS712694 5x 5 µm

Tissue FFPE Sections, Meninges

Sign In for Pricing
View Details
RNF168 Recombinant Rabbit Monoclonal Antibody [PSH07-37]
HA722825 100 µL

RNF168 Recombinant Rabbit Monoclonal Antibody [PSH07-37]

Sign In for Pricing
View Details
Cabozantinib Des-O-fluoroaniline
TRC-C051610-10MG 10 mg

Cabozantinib Des-O-fluoroaniline

Sign In for Pricing
View Details
Glucose b-O-BSA Colloidal Gold Conjugate, 1mL 20nm
CCG-1001-20 1 mL

Glucose b-O-BSA Colloidal Gold Conjugate, 1mL 20nm

Sign In for Pricing
View Details
PHF7 (NM_016483) Human Over-expression Lysate
LY402558 100 µg

PHF7 (NM_016483) Human Over-expression Lysate

Sign In for Pricing
View Details