Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Daam2 Peptide - N-terminal region

Daam2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310016D11Rik, AI843643, AW557870

UniProt

Q80U19

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Daam2 Rabbit Polyclonal Antibody (orb586163) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008232

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFAELVDELD LTDKNREAVFALPPEKKWQIYCSKRKEQEDPNKLATSWP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFA2 Rabbit Polyclonal Antibody
AP20269PU-N 100 µg

RFA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Serf1 activation kit by CRISPRa
GA203849 1 Kit

Mouse Serf1 activation kit by CRISPRa

Sign In for Pricing
View Details
4-Propoxyphenol
TRC-P839240-500MG 500 mg

4-Propoxyphenol

Sign In for Pricing
View Details
MEGF9 Antibody
KC-26571-01 50 μL

MEGF9 Antibody

Sign In for Pricing
View Details
MEGF9 Antibody
KC-26571-02 100 µL

MEGF9 Antibody

Sign In for Pricing
View Details
MEGF9 Antibody
KC-26571-03 1 mL

MEGF9 Antibody

Sign In for Pricing
View Details