GLIPR2 Peptide - C-terminal region
GLIPR2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GAPR1, GAPR-1, C9orf19
UniProt
Q9H4G4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GLIPR2 Rabbit Polyclonal Antibody (orb326998) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_071738.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GP-1901-30 1 mL
Colloidal Gold Conjugated Phytolacca americana Lectin (Pokeweed) -PWM, PWA-, 30nm
Sign In for Pricing
View Details 
BNCB2576-100 1x 100 µL
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2576), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GAF-532-15 1 mL
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Equine IgG, Fc Specific, 15nm
Sign In for Pricing
View Details 
![PDGF Receptor beta (PDGFRB) Mouse Monoclonal Antibody [Clone ID: 1A2]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbd81/imageurl/am06349su-n.webp)
AM06349SU-N 100 µL
PDGF Receptor beta (PDGFRB) Mouse Monoclonal Antibody [Clone ID: 1A2]
Sign In for Pricing
View Details 