GLIPR2 Peptide - C-terminal region
GLIPR2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GAPR1, GAPR-1, C9orf19
UniProt
Q9H4G4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GLIPR2 Rabbit Polyclonal Antibody (orb326998) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_071738.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GM-503-15 1 mL
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Horseradish Peroxidase, 15nm
Sign In for Pricing
View Details 
![GFI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C10]](https://cdn.genprice.uk/products/937/6868c3d7994c49e6dc40011f/imageurl/ta807139bm.webp)
TA807139BM 100 µL
GFI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C10]
Sign In for Pricing
View Details 
LC422668 20 µg
APPBP1 (NAE1) (NM_001018160) Human Over-expression Lysate
Sign In for Pricing
View Details