Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOLPH3L Peptide - N-terminal region

GOLPH3L Peptide - N-terminal region

Product Specifications

Product Name Alternative

GPP34R

UniProt

Q9H4A5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GOLPH3L Rabbit Polyclonal Antibody (orb587437) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060648

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human AANAT
MBS7610562-01 0.05 mg

Recombinant Human AANAT

Sign In for Pricing
View Details
Recombinant Human AANAT
MBS7610562-02 0.2 mg

Recombinant Human AANAT

Sign In for Pricing
View Details
Recombinant Human AANAT
MBS7610562-03 1 mg

Recombinant Human AANAT

Sign In for Pricing
View Details
Recombinant Human AANAT
MBS7610562-04 5x 1 mg

Recombinant Human AANAT

Sign In for Pricing
View Details
IGF-II, Pro, Recombinant, Human (Insulin Like Growth Factor-II) discontinued
368994-01 10 µg

IGF-II, Pro, Recombinant, Human (Insulin Like Growth Factor-II) discontinued

Sign In for Pricing
View Details
IGF-II, Pro, Recombinant, Human (Insulin Like Growth Factor-II) discontinued
368994-02 100 µg

IGF-II, Pro, Recombinant, Human (Insulin Like Growth Factor-II) discontinued

Sign In for Pricing
View Details