GPR89A Peptide - C-terminal region
GPR89A Peptide - C-terminal region
Product Specifications
Product Name Alternative
GPHR, GPR89, SH120
UniProt
B7ZAQ6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GPR89A Rabbit Polyclonal Antibody (orb587439) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057418
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LEYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHKQAPEKQM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bsm-52057R-BF647-TR 20 µL
Cytokeratin 17 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
Sign In for Pricing
View Details 
MBS1345452-01 0.02 mg (E-Coli)
Recombinant Bartonella henselae SsrA-binding protein (smpB)
Sign In for Pricing
View Details MBS1345452-02 0.1 mg (E-Coli)
Recombinant Bartonella henselae SsrA-binding protein (smpB)
Sign In for Pricing
View Details MBS1345452-03 0.02 mg (Yeast)
Recombinant Bartonella henselae SsrA-binding protein (smpB)
Sign In for Pricing
View Details MBS1345452-04 0.1 mg (Yeast)
Recombinant Bartonella henselae SsrA-binding protein (smpB)
Sign In for Pricing
View Details MBS1345452-05 0.02 mg (Baculovirus)
Recombinant Bartonella henselae SsrA-binding protein (smpB)
Sign In for Pricing
View Details