GPR89A Peptide - C-terminal region
GPR89A Peptide - C-terminal region
Product Specifications
Product Name Alternative
GPHR, GPR89, SH120
UniProt
B7ZAQ6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GPR89A Rabbit Polyclonal Antibody (orb587439) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057418
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LEYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHKQAPEKQM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10473464 96 Well
Canine β citryl glutamate synthase B (RIMKLB) ELISA kit
Sign In for Pricing
View Details 
RC222228L2V 200 µL
PCDH11X (NM_032968) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 