Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRAP Peptide - N-terminal region

GRAP Peptide - N-terminal region

Product Specifications

UniProt

Q13588

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRAP Rabbit Polyclonal Antibody (orb331389) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006604

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPWYSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB8 Antibody
KC-2609-01 50 μL

SERPINB8 Antibody

Sign In for Pricing
View Details
SERPINB8 Antibody
KC-2609-02 100 µL

SERPINB8 Antibody

Sign In for Pricing
View Details
SERPINB8 Antibody
KC-2609-03 1 mL

SERPINB8 Antibody

Sign In for Pricing
View Details
Endophenazine A
TRC-E555480-25MG 25 mg

Endophenazine A

Sign In for Pricing
View Details
Recombinant Galectin 7 Antibody
RC-15913-01 50 μL

Recombinant Galectin 7 Antibody

Sign In for Pricing
View Details
Recombinant Galectin 7 Antibody
RC-15913-02 100 µL

Recombinant Galectin 7 Antibody

Sign In for Pricing
View Details