Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRAP Peptide - N-terminal region

GRAP Peptide - N-terminal region

Product Specifications

UniProt

Q13588

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GRAP Rabbit Polyclonal Antibody (orb331389) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006604

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPWYSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK5 (MAP2K5) (NM_002757) Human Over-expression Lysate
LY419128 100 µg

MEK5 (MAP2K5) (NM_002757) Human Over-expression Lysate

Sign In for Pricing
View Details
ER81 (ETV1) (NM_004956) Human Over-expression Lysate
LC401540 20 µg

ER81 (ETV1) (NM_004956) Human Over-expression Lysate

Sign In for Pricing
View Details
NARG2 (ICE2) Human Gene Knockout Kit (CRISPR)
KN418525 1 Kit

NARG2 (ICE2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tac4 Mouse Gene Knockout Kit (CRISPR)
KN517122 1 Kit

Tac4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Solution Reservoir
P8025-5S 200 Units/Case

Solution Reservoir

Sign In for Pricing
View Details
ZNF883 Human Gene Knockout Kit (CRISPR)
KN425578 1 Kit

ZNF883 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details